PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0418s0011.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 126aa    MW: 14002.4 Da    PI: 10.9721
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0418s0011.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.69.4e-202963135
                 GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                         Cs C+ttkTp+WR gp g+k+LCnaCG+++rk+++
  Cagra.0418s0011.1.p 29 CSDCKTTKTPMWRGGPTGPKSLCNACGIRFRKQRR 63
                         ********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577164.18E-142163No hitNo description
SMARTSM004015.4E-172379IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.5052359IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.107.8E-162763IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.35E-112963No hitNo description
PfamPF003208.6E-182963IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402954IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0048527Biological Processlateral root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MDPRVQVRSR SSTYVSARME EEKKITRCCS DCKTTKTPMW RGGPTGPKSL CNACGIRFRK  60
QRRSELLGIH IIHSHKTLNS KKLNPKTSSL SSHGGVAVKK RRRSLKEEEQ AALCLLLLSC  120
SSVFA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006289523.12e-76hypothetical protein CARUB_v10003065mg
SwissprotQ8LC596e-52GAT23_ARATH; GATA transcription factor 23
TrEMBLR0FJX92e-76R0FJX9_9BRAS; Uncharacterized protein
STRINGAT5G26930.12e-49(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144841622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.11e-53GATA transcription factor 23